PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05956g01010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 548aa    MW: 61127.8 Da    PI: 6.6654
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05956g01010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.3e-162862135
                      GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                              C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Niben101Scf05956g01010.1 28 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 62
                              ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.4E-102274IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.99E-112567No hitNo description
CDDcd002021.01E-162776No hitNo description
Gene3DG3DSA:3.30.50.102.9E-122862IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.22861IPR000679Zinc finger, GATA-type
PfamPF003201.0E-132862IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402853IPR000679Zinc finger, GATA-type
PfamPF139191.2E-7302384IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MSQEIAVAVK ATTAMDAIYL WMGKEGPCYH CGVTSTPLWR NGPPEKPILC NACGSRWRTK  60
GTLANYTPLH ARAEPCDFEE HRVSRFKNMP MKNKEAKFLK QKQSHDMVEV GSPPDYNFGF  120
RKCLDEDISN RSSSGSVVSN SESCAQFGSA EASDLTGPAP SNIWDTTVPS KKRTCSNRPK  180
PSSVEKLTKD LYTILHEQQL SSCFSASSED DLLFESEKPM VSVEIGHGSM LIRHPSSIGR  240
EEESEASSLS VDNKHCSVNE AYSRLTTRPV NISKGVNSPN MGADRTKKTI GQAVEQDQIK  300
RNKEKLETLQ ILGHHNSPLR YIELKDVLNY EEFMMHLSSD EQQQLLKYLP PVDSFAPPDS  360
LRSMFESSQF EENVSFFQKL LAECVFDNSL PGVKLEDCRT LKRFILCYLS KSKWVEQYNL  420
LKDTKCKNSS SGSEVAGEQS VIGTCHSVNV KRPREGHHLK YSGAKTTMNS PKSMVMKSIY  480
EQKELLDNDG SCSSPKSSFA LPSETSSLVL DSFHSANENS DQDLLLNVPS NSYFPQAELL  540
LPTSSFTP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789570.10.0PREDICTED: GATA transcription factor 26-like
RefseqXP_016470951.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-143GAT26_ARATH; GATA transcription factor 26
TrEMBLM1BTZ40.0M1BTZ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000528000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-145GATA transcription factor 26